PDB entry 1c9r

View 1c9r on RCSB PDB site
Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Deposited on 1999-08-03, released 1999-09-01
The last revision prior to the SCOP 1.59 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.262
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9rA (A:)
    pispietvpvklapgmdgpkvkqwpltaeaiaalvaictameaegkiskigpenpyntpv
    faikkaaaaaaaalvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsianatpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqyiddlyvgsdleigqhatkiaelrqhllawglttpdkkhaaeppflwmgyelhpdawt
    vapaalaaaasaavndiqklvgklnwasqiypgiavralsaaaagtkaaaeaaaataaaa
    lalaaarealaapvhgvyydpskdliaeiqaqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanaatklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiiealikkeavylawvpaha
    giggnaavdalvsagiaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9rB (B:)
    pispietvpvklapgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfweaalgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkaqnpdivi
    yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwa
    aaaaaaaaaaaatvndiqklvgklnwaaqiypgiaaaalsaalagtkaltaaapltaaaa
    lelaanraaaaaaaagvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvalwyale
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9rH (H:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssaattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9rL (L:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqdskdstysmsstlt
    ltadeyeaansytcaathktstspivksfnanec