PDB entry 1c9p

View 1c9p on RCSB PDB site
Description: complex of bdellastasin with porcine trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: complex (hydrolase-inhibitor), hydrolase, inhibitor, antistasin, plasmin, isoaspartate, hydrolase-hydrolase inhibitor complex
Deposited on 1999-08-03, released 2000-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • engineered (96)
    Domains in SCOPe 2.07: d1c9pa_
  • Chain 'B':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9pb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c9pA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1c9pB (B:)
fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq

    Sequence, based on observed residues (ATOM records): (download) 
    >1c9pB (B:)
cgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq