PDB entry 1c9f

View 1c9f on RCSB PDB site
Description: nmr structure of the cad domain of caspase-activated DNAse
Class: hydrolase
Keywords: alpha-beta roll, hydrolase
Deposited on 1999-08-02, released 2000-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-activated DNAse
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1c9fA (A:)
vphmcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgte
vtddcfpglpndaelllltagetwhgyvsd

    Sequence, based on observed residues (ATOM records): (download) 
    >1c9fA (A:)
mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
dcfpglpndaelllltagetwhgyvsd