PDB entry 1c8s

View 1c8s on RCSB PDB site
Description: bacteriorhodopsin d96n late m state intermediate
Deposited on 1999-07-29, released 1999-10-20
The last revision prior to the SCOP 1.61 freeze date was dated 1999-10-20, with a file datestamp of 1999-10-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1c8sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8sA (A:)
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttpllllnlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlfnvtvvlwsaypvvwligsegagivplnietl
lfmvldvsakvgfgli