PDB entry 1c8p

View 1c8p on RCSB PDB site
Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Class: membrane protein
Keywords: beta sandwich, cytokine receptor, fn3 domain, membrane protein
Deposited on 1999-10-05, released 2000-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytokine receptor common beta chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32927 (0-101)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1c8pa1, d1c8pa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c8pA (A:)
  miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
  malpalepstrywarvrvrtsrtgyngiwsewsearswdtes