PDB entry 1c86

View 1c86 on RCSB PDB site
Description: crystal structure of protein tyrosine phosphatase 1b (r47v,d48n) complexed with 2-(oxalyl-amino-4,7-dihydro-5h-thieno[2,3-c]pyran-3-carboxylic acid
Class: hydrolase
Keywords: hydrolase, phosphorylation, ligand, inhibitor
Deposited on 2000-04-16, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protein-tyrosine phosphatase 1b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (Start-297)
      • engineered (46-47)
      • conflict (150)
      • conflict (251)
    Domains in SCOPe 2.07: d1c86a_
  • Heterogens: OPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c86A (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryvnvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c86A (A:)
    mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryvnvspfdhsriklhqe
    dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
    qywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpdf
    gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
    svdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed