PDB entry 1c7p

View 1c7p on RCSB PDB site
Description:
Deposited on 2000-02-29, released 2000-04-05
The last revision prior to the SCOP 1.71 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1c7pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7pA (A:)
    eaeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygi
    fqinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrc
    qnrdvrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7pA (A:)
    aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygif
    qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
    nrdvrqyvqgcgv