PDB entry 1c7k

View 1c7k on RCSB PDB site
Description: crystal structure of the zinc protease
Deposited on 2000-02-19, released 2001-04-25
The last revision prior to the SCOP 1.61 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.154
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1c7ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c7kA (A:)
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang