PDB entry 1c7c

View 1c7c on RCSB PDB site
Description: deoxy rhb1.1 (recombinant hemoglobin)
Class: oxygen storage/transport
Keywords: heme, oxygen delivery vehicle, blood substitute
Deposited on 2000-02-09, released 2000-06-30
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (deoxyhemoglobin (alpha chain))
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (142-282)
      • engineered (0)
      • see remark 999 (141)
    Domains in SCOP 1.73: d1c7ca1, d1c7ca2
  • Chain 'B':
    Compound: protein (deoxyhemoglobin (beta chain))
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (107)
    Domains in SCOP 1.73: d1c7cb_
  • Chain 'D':
    Compound: protein (deoxyhemoglobin (beta chain))
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (107)
    Domains in SCOP 1.73: d1c7cd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrgvlspadktnvkaawgkvgahageygaealermflsfpt
    tktyfphfdlshgsaqvkghgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnf
    kllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh