PDB entry 1c7c

View 1c7c on RCSB PDB site
Description: deoxy rhb1.1 (recombinant hemoglobin)
Deposited on 2000-02-09, released 2000-06-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-30, with a file datestamp of 2000-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrgvlspadktnvkaawgkvgahageygaealermflsfpt
    tktyfphfdlshgsaqvkghgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnf
    kllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7cD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh