PDB entry 1c76

View 1c76 on RCSB PDB site
Description: staphylokinase (sak) monomer
Deposited on 2000-02-01, released 2000-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-01, with a file datestamp of 2000-08-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c76a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c76A (A:)
syfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvewaldatayke
frvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnlitkvviek
k