PDB entry 1c75

View 1c75 on RCSB PDB site
Description: 0.97 a "ab initio" crystal structure of cytochrome c-553 from bacillus pasteurii
Class: electron transport
Keywords: c-553, heme, cytochrome, bacillus pasteurii, ab initio, atomic resolution, electron transport
Deposited on 2000-02-09, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c-553
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82599 (0-70)
  Domains in SCOPe 2.07: d1c75a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c75A (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk