PDB entry 1c6s

View 1c6s on RCSB PDB site
Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures
Class: electron transport
Keywords: cytochrome c6, electron transport, nmr structure, photosynthesis, synechococcus elongatus
Deposited on 1997-03-31, released 1998-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c6sa_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6sA (A:)
    adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
    fagrltdeqiqdvaayvldqaakgwag