PDB entry 1c6s

View 1c6s on RCSB PDB site
Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures
Deposited on 1997-03-31, released 1998-04-08
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1c6s__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c6s_ (-)
  adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
  fagrltdeqiqdvaayvldqaakgwag