PDB entry 1c6r

View 1c6r on RCSB PDB site
Description: crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus
Class: electron transport
Keywords: electron transport protein, cytochrome-c6, reduced state, photosynthesis
Deposited on 1999-04-06, released 2000-04-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Scenedesmus obliquus [TaxId:3088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1c6ra_
  • Heterogens: CD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c6rA (A:)
    sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
    mpawsgtldddeiaavaayvydqasgdkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6rA (A:)
    adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
    pawsgtldddeiaavaayvydqasgdkw