PDB entry 1c6r

View 1c6r on RCSB PDB site
Description: crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus
Deposited on 1999-04-06, released 2000-04-12
The last revision prior to the SCOP 1.59 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1c6ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6rA (A:)
    adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
    pawsgtldddeiaavaayvydqasgdkw