PDB entry 1c6o

View 1c6o on RCSB PDB site
Description: crystal structure of oxidized cytochrome c6 from the green algae scenedesmus obliquus
Class: electron transport
Keywords: electron transport protein, cytochrome-c6, oxidized state, photosynthesis, dimerization, electron transport
Deposited on 1999-04-07, released 2000-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: Scenedesmus obliquus [TaxId:3088]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57736 (0-88)
  Domains in SCOPe 2.07: d1c6oa_
• Chain 'B':
  Compound: cytochrome c6
  Species: Scenedesmus obliquus [TaxId:3088]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57736 (0-88)
  Domains in SCOPe 2.07: d1c6ob_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c6oA (A:)
  sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
  mpawsgtldddeiaavaayvydqasgdkw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c6oB (B:)
  sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
  mpawsgtldddeiaavaayvydqasgdkw