PDB entry 1c6o

View 1c6o on RCSB PDB site
Description: crystal structure of oxidized cytochrome c6 from the green algae scenedesmus obliquus
Class: electron transport
Keywords: electron transport protein, cytochrome-c6, oxidized state, photosynthesis, dimerization
Deposited on 1999-04-07, released 2000-04-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Scenedesmus obliquus [TaxId:3088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1c6oa_
  • Chain 'B':
    Compound: cytochrome c6
    Species: Scenedesmus obliquus [TaxId:3088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1c6ob_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6oA (A:)
    sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
    mpawsgtldddeiaavaayvydqasgdkw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6oB (B:)
    sadlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkga
    mpawsgtldddeiaavaayvydqasgdkw