PDB entry 1c5d

View 1c5d on RCSB PDB site
Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
Deposited on 1999-11-17, released 1999-12-03
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dA (A:)
    diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
    rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleikradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dB (B:)
    evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
    salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvssaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdkklerr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dH (H:)
    evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
    salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvssaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdkkler
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dL (L:)
    diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
    rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleikradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec