PDB entry 1c5d

View 1c5d on RCSB PDB site
Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
Class: immune system
Keywords: immunoglobulin, immune system
Deposited on 1999-11-17, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C5D (0-212)
    Domains in SCOPe 2.07: d1c5da1, d1c5da2
  • Chain 'B':
    Compound: monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C5D (0-214)
    Domains in SCOPe 2.07: d1c5db1, d1c5db2
  • Chain 'H':
    Compound: monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C5D (0-End)
    Domains in SCOPe 2.07: d1c5dh1, d1c5dh2
  • Chain 'L':
    Compound: monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C5D (0-212)
    Domains in SCOPe 2.07: d1c5dl1, d1c5dl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dA (A:)
    diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
    rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleikradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dB (B:)
    evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
    salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvssaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdkklerr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c5dH (H:)
    evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
    salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvssaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdkklerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5dH (H:)
    evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
    salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvssaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdkkler
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5dL (L:)
    diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
    rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleikradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec