PDB entry 1c5b

View 1c5b on RCSB PDB site
Description: decarboxylase catalytic antibody 21d8 unliganded form
Deposited on 1999-11-08, released 2000-10-11
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5bH (H:)
    qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
    ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5bL (L:)
    eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
    rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec