PDB entry 1c53

View 1c53 on RCSB PDB site
Description: s-class cytochromes c have a variety of folding patterns: structure of cytochrome c-553 from desulfovibrio vulgaris determined by the multi-wavelength anomalous dispersion method
Class: electron transport
Keywords: electron transport
Deposited on 1991-08-26, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c553
  Species: Desulfovibrio vulgaris
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00120 (0-78)
  Domains in SCOP 1.75: d1c53a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c53A (A:)
  adgaalykscvgchgadgskqamgvghavkgqkadelfkklkgyadgsyggekkavmtnl
  vkrysdeemkamadymskl