PDB entry 1c52

View 1c52 on RCSB PDB site
Description: thermus thermophilus cytochrome-c552: a new highly thermostable cytochrome-c structure obtained by mad phasing
Deposited on 1997-06-23, released 1998-06-24
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-24, with a file datestamp of 1998-06-24.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.191
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1c52__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c52_ (-)
  qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev
  kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq
  vlaerkklglk