PDB entry 1c4w

View 1c4w on RCSB PDB site
Description: 1.9 a structure of a-thiophosphonate modified chey d57c
Class: signaling protein
Keywords: Phosphono-CheY,Active Form of the Response Regulator, Chemotaxis
Deposited on 1999-09-28, released 2000-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2002-04-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.208
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-127)
    • engineered (55)
  Domains in SCOP 1.75: d1c4wa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c4wA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
  nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm