PDB entry 1c4o

View 1c4o on RCSB PDB site
Description: crystal structure of the dna nucleotide excision repair enzyme uvrb from thermus thermophilus
Deposited on 1999-09-14, released 2000-07-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.252
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4oA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn
    didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp
    athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv
    enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf
    rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirptglldplvrvkp
    tenqildlmegireraargertlvtvltvrmaeeltsflvehgirarylhheldafkrqa
    lirdlrlghydclvginllregldipevslvaildadkegflrsersliqtigraarnar
    gevwlyadrvseamqraieetnrrralqeaynlehgitpetv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4oA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvgfvlfpathylspegleeilkeie
    kelwervryfeergevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppyt
    lldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeefle
    rvsqvvfvsatpgpfelahsgrvveqiirptglldplvrvkptenqildlmegireraar
    gertlvtvltvrmaeeltsflvehgirarylhheldafkrqalirdlrlghydclvginl
    lregldipevslvaildadkegflrsersliqtigraarnargevwlyadrvseamqrai
    eetnrrralqeaynlehgitpetv