PDB entry 1c4a

View 1c4a on RCSB PDB site
Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum
Deposited on 1999-08-13, released 1999-12-22
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4aA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykk