PDB entry 1c40

View 1c40 on RCSB PDB site
Description: bar-headed goose hemoglobin (aquomet form)
Class: oxygen storage/transport
Keywords: oxygen transport, heme, respiratory protein, erythrocyte, oxygen storage/ transport, oxygen storage-transport complex
Deposited on 1999-08-03, released 1999-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin (alpha chain))
    Species: Anser indicus [TaxId:8846]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01990 (0-140)
      • conflict (84)
    Domains in SCOPe 2.07: d1c40a_
  • Chain 'B':
    Compound: protein (hemoglobin (beta chain))
    Species: Anser indicus [TaxId:8846]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c40b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c40A (A:)
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c40B (B:)
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh