PDB entry 1c40

View 1c40 on RCSB PDB site
Description: bar-headed goose hemoglobin (aquomet form)
Deposited on 1999-08-03, released 1999-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-09, with a file datestamp of 1999-08-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c40a_
  • Chain 'B':
    Domains in SCOP 1.55: d1c40b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c40A (A:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c40B (B:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh