PDB entry 1c3z

View 1c3z on RCSB PDB site
Description: thp12-carrier protein from yellow meal worm
Class: antifreeze PROTEIN
Keywords: EF-HAND, ALL-ALPHA, antifreeze PROTEIN
Deposited on 1999-07-10, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thp12 carrier protein
    Species: Tenebrio molitor [TaxId:7067]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3zA (A:)
    etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
    ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs