PDB entry 1c3z

View 1c3z on RCSB PDB site
Description: thp12-carrier protein from yellow meal worm
Deposited on 1999-07-10, released 1999-11-10
The last revision prior to the SCOP 1.61 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1c3za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3zA (A:)
    etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
    ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs