PDB entry 1c3w

View 1c3w on RCSB PDB site
Description: bacteriorhodopsin/lipid complex at 1.55 a resolution
Deposited on 1999-07-28, released 1999-09-15
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-22, with a file datestamp of 1999-09-21.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.158
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1c3wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3wA (A:)
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg