PDB entry 1c3t

View 1c3t on RCSB PDB site
Description: rotamer strain as a determinant of protein structural specificity
Class: de novo protein
Keywords: protein design, hydrophobic core, packing, rotamers, roc, ubiquitin, de novo protein, ubiquitin
Deposited on 1999-07-28, released 1999-08-20
The last revision prior to the SCOP 1.73 freeze date was dated 2000-07-05, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.96 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (1d8 ubiquitin)
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62988 (0-75)
    • mutation (2)
    • mutation (12)
    • mutation (14)
    • mutation (16)
    • mutation (22)
    • mutation (25)
    • mutation (60)
    • mutation (66)
  Domains in SCOP 1.73: d1c3ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c3tA (A:)
  mqlfvktltgktltvelepsdtvenlkakiqdkegippdqqrlifagkqledgrtlsdyn
  lqkestihlvlrlrgg