PDB entry 1c2o

View 1c2o on RCSB PDB site
Description: electrophorus electricus acetylcholinesterase
Class: hydrolase
Keywords: serine hydrolase, alpha/beta hydrolase, tetramer, hydrolase
Deposited on 1999-07-26, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.375
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Electrophorus electricus [TaxId:8005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c2oa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Electrophorus electricus [TaxId:8005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c2ob_
  • Chain 'C':
    Compound: acetylcholinesterase
    Species: Electrophorus electricus [TaxId:8005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c2oc_
  • Chain 'D':
    Compound: acetylcholinesterase
    Species: Electrophorus electricus [TaxId:8005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c2od_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2oA (A:)
    dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
    fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
    sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
    eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
    rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
    gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
    igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
    vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
    rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2oB (B:)
    dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
    fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
    sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
    eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
    rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
    gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
    igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
    vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
    rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2oC (C:)
    dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
    fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
    sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
    eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
    rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
    gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
    igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
    vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
    rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2oD (D:)
    dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
    fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
    sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
    eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
    rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
    gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
    igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
    vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
    rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat