PDB entry 1c2b

View 1c2b on RCSB PDB site
Description: electrophorus electricus acetylcholinesterase
Class: hydrolase
Keywords: serine hydrolase, alpha/beta hydrolase, tetramer, hydrolase
Deposited on 1999-07-26, released 1999-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: 0.369
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Electrophorus electricus [TaxId:8005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c2ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c2bA (A:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2bA (A:)
    dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
    fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
    sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
    eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
    rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
    gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
    igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
    vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
    rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat