PDB entry 1c1d

View 1c1d on RCSB PDB site
Description: l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine
Deposited on 1999-07-21, released 2000-08-30
The last revision prior to the SCOP 1.63 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.195
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1dA (A:)
    sidsalnwdgemtvtrfdamtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1dB (B:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrarea