PDB entry 1c0n

View 1c0n on RCSB PDB site
Description: csdb protein, nifs homologue
Class: lyase
Keywords: alpha/beta fold, lyase
Deposited on 1999-07-17, released 2000-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (csdb protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0na_
  • Heterogens: PLP, ACY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0nA (A:)
    mifsvdavradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhagaht
    lsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisq
    mehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdaatrllaithvsnvlgte
    nplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvke
    allqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgln
    niaeyeqnlmhyalsqlesvpdltlygpqarlgviafnlgahhaydvgsfldnygiavrt
    ghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0nA (A:)
    fsvdavradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhagahtls
    aqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqme
    hhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdaatrllaithvsnvlgtenp
    laemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkeal
    lqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnni
    aeyeqnlmhyalsqlesvpdltlygpqarlgviafnlgahhaydvgsfldnygiavrtgh
    hcamplmayynvpamcraslamyntheevdrlvtglqrihrllg