PDB entry 1c09

View 1c09 on RCSB PDB site
Description: rubredoxin v44a cp
Class: electron transport
Keywords: iron, metal-binding, 3d-structure, electron transport
Deposited on 1999-07-15, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (43)
    Domains in SCOPe 2.07: d1c09a_
  • Chain 'B':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (43)
    Domains in SCOPe 2.07: d1c09b_
  • Chain 'C':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (43)
    Domains in SCOPe 2.07: d1c09c_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c09A (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c09A (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeeve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c09B (B:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c09B (B:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeeve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c09C (C:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c09C (C:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgagkdqfeeve