PDB entry 1c06

View 1c06 on RCSB PDB site
Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (ensemble of 16 structures)
Class: ribosome
Keywords: two subdomains, unique topology, possible helix-turn helix motif, ribosome
Deposited on 1999-07-14, released 1999-09-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosomal protein s4 delta 41
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81288 (0-158)
  Domains in SCOPe 2.02: d1c06a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c06A (A:)
  mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
  glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
  pdylsfdpekmegtytrlperselpaeinealivefysr