PDB entry 1c04

View 1c04 on RCSB PDB site
Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui
Deposited on 1999-07-14, released 1999-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1999-11-05, with a file datestamp of 1999-11-04.
Experiment type: XRAY
Resolution: 5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1c04a_
  • Chain 'B':
    Domains in SCOP 1.59: d1c04b_
  • Chain 'C':
    Domains in SCOP 1.59: d1c04c_
  • Chain 'D':
    Domains in SCOP 1.59: d1c04d_
  • Chain 'E':
    Domains in SCOP 1.59: d1c04e_
  • Chain 'F':
    Domains in SCOP 1.59: d1c04f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c04A (A:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c04B (B:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c04C (C:)
    ktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamrmieg
    tarsmgi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c04D (D:)
    miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
    vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
    vi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.