PDB entry 1bzp

View 1bzp on RCSB PDB site
Description: atomic resolution crystal structure analysis of native deoxy and co myoglobin from sperm whale at room temperature
Deposited on 1998-11-02, released 1999-05-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-10, with a file datestamp of 1999-05-09.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.114
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1bzpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bzpA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg