PDB entry 1bzh

View 1bzh on RCSB PDB site
Description: Cyclic peptide inhibitor of human PTP1B
Class: hydrolase/hydrolase inhibitor
Keywords: PHOSPHORYLATION-INHIBITOR COMPLEX, TYROSINE PHOSPHATASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-10-28, released 1999-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protein-tyrosine-phosphatase 1b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (Start-297)
      • conflict (251)
      • conflict (264)
    Domains in SCOPe 2.03: d1bzha_
  • Chain 'I':
    Compound: protein (protein-tyrosine-phosphatase 1b inhibitor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BZH (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bzhA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvlldmrkfrmgliqtaeqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzhA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvlldmrkfrmgliqtaeqlrfsylaviegakfimgdssvqdqwkelshed
    

  • Chain 'I':
    No sequence available.