PDB entry 1bz7

View 1bz7 on RCSB PDB site
Description: fab fragment from murine ascites
Deposited on 1998-11-06, released 1999-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.162
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bz7A (A:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bz7B (B:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdk