PDB entry 1byq

View 1byq on RCSB PDB site
Description: hsp90 n-terminal domain bound to ADP-mg
Class: chaperone
Keywords: chaperone protein, ATP binding
Deposited on 1998-10-19, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heat shock protein 90)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byqa_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1byqA (A:)
    dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdps
    kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
    smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
    hlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byqA (A:)
    pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskl
    dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
    igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
    kedqteyleerrikeivkkhsqfigypitlfve