PDB entry 1byp

View 1byp on RCSB PDB site
Description: e43k,d44k double mutant plastocyanin from silene
Deposited on 1998-10-19, released 1999-10-19
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-19, with a file datestamp of 1999-10-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1bypa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bypA (A:)
  aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdkkevpagvdvtkismpee
  dllnapgeeysvtltekgtykfycaphagagmvgkvtvn