PDB entry 1byk

View 1byk on RCSB PDB site
Description: trehalose repressor from escherichia coli
Class: gene regulation
Keywords: laci family, phosphate binding, protein structure, trehalose repressor, gene regulation
Deposited on 1998-10-16, released 1999-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.173
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (trehalose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1byka_
  • Chain 'B':
    Compound: protein (trehalose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bykb_
  • Heterogens: T6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bykA (A:)
    sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
    gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
    lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
    dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
    grsepqqiiipatls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bykB (B:)
    sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
    gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
    lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
    dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
    grsepqqiiipatls