PDB entry 1byg

View 1byg on RCSB PDB site
Description: kinase domain of human c-terminal src kinase (csk) in complex with inhibitor staurosporine
Class: transferase
Keywords: protein kinase, c-terminal src kinase, phosphorylation, staurosporine, transferase
Deposited on 1998-10-14, released 1999-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (c-terminal src kinase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1byga_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bygA (A:)
    mggsvaaqdefyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqa
    flaeasvmtqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcll
    kfsldvceameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkw
    tapealrekkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcp
    pavyevmkncwhldaamrpsflqlreqlehikthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bygA (A:)
    gwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndaqaflaeasvmtqlrhsnl
    vqllgviveeglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameylegnnf
    vhrdlaarnvlvsednvakvsdfgllpvkwtapealrekkfstksdvwsfgillweiysf
    grvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsflqlreqleh
    ikthel