PDB entry 1bye

View 1bye on RCSB PDB site
Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate
Deposited on 1998-10-14, released 1998-10-21
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeA (A:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeB (B:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeC (C:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeD (D:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa