PDB entry 1bya

View 1bya on RCSB PDB site
Description: crystal structures of soybean beta-amylase reacted with beta-maltose and maltal: active site components and their apparent role in catalysis
Deposited on 1994-01-25, released 1994-07-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bya__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bya_ (-)
    snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
    kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
    nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
    gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
    tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
    venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
    qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
    llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
    wlpetdmkvdg