PDB entry 1by1

View 1by1 on RCSB PDB site
Description: DBL homology domain from beta-PIX
Class: transport protein
Keywords: rho-gtpase exchange factor, transport protein
Deposited on 1998-10-22, released 1999-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pix)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14155 (0-208)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1by1a1, d1by1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1by1A (A:)
    mkgfdttainksyynvvlqnileteneyskelqtvlstylrplqtseklssanisylmgn
    leeicsfqqmlvqsleectklpeaqqrvggcflnlmpqmktlyltycanhpsavnvlteh
    seelgefmetkgasspgilvlttglskpfmrldkyptllkelerhmedyhtdrqdiqksm
    aafknlsaqcqevrkrkelelqilteair