PDB entry 1bxn

View 1bxn on RCSB PDB site
Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
Deposited on 1998-10-06, released 1999-10-06
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-05, with a file datestamp of 2000-06-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.266
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnA (A:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnC (C:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnE (E:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnG (G:)
    ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
    yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
    fpvayvktfagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldf
    mkddeninsqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefaks
    lgsviimvdlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrl
    agvdhmhtgtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasg
    gihagqmhqlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilne
    gpeilrdaarwcgplraaldtwgdi
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnI (I:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnJ (J:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnK (K:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxnL (L:)
    mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
    aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
    lrysiesya